(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE420

CP000124.PE420       Location/Qualifiers
FT   CDS             complement(443459..444271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0429"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49878"
FT                   /db_xref="GOA:Q3JX60"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX60"
FT                   /protein_id="ABA49878.1"
FT                   /translation="MHVPQTAPLAEPLPVADEITAVSWNLHKGRSPLGFTAWEAMRSWV
FT                   ASTHADVYFLQEAMARRMPRPVLAAGFGAPMAEPVDDIWHCQATEIARALDWQIALGPN
FT                   VFKPSWRHGNAILSPHPLDLGGRWDISAHRFERRGLLVARATLAGGAPVTLLCAHLALT
FT                   RAARLRQMHWIAHWIERNARTGPLVLAGDFNDWRNDSIPLFGEIGLSEVATLLGESGRT
FT                   FPAFSPALALDKMFVRGMTPLEWRAPGDETAWLSDHLPYVARLRLDPA"
     MHVPQTAPLA EPLPVADEIT AVSWNLHKGR SPLGFTAWEA MRSWVASTHA DVYFLQEAMA        60
     RRMPRPVLAA GFGAPMAEPV DDIWHCQATE IARALDWQIA LGPNVFKPSW RHGNAILSPH       120
     PLDLGGRWDI SAHRFERRGL LVARATLAGG APVTLLCAHL ALTRAARLRQ MHWIAHWIER       180
     NARTGPLVLA GDFNDWRNDS IPLFGEIGLS EVATLLGESG RTFPAFSPAL ALDKMFVRGM       240
     TPLEWRAPGD ETAWLSDHLP YVARLRLDPA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page