(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE425

CP000124.PE425       Location/Qualifiers
FT   CDS             446254..447375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0434"
FT                   /product="oxidoreductase, FAD-binding family protein"
FT                   /EC_number="1.2.1.19"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49281"
FT                   /db_xref="GOA:Q3JX55"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX55"
FT                   /protein_id="ABA49281.1"
FT                   /translation="MTIERIDCVVIGAGVVGLAIARELAARGRETLILEAADAIGTGMS
FT                   SRNSEVIHAGLYYPRGSLKASLCLHGRDLLYDFCETHGVPHRRCGKLVVATSPAQAKQL
FT                   KAIAARAEENGVLDLLTLSRDEVQALEPELECLEALFSPSTGIIDSHQLMLALLGDAER
FT                   DGASCALRSPVESIDAAGGRFVVRTGGEAPAAIAAACVINSAGLDAQALAKRIRGLDSR
FT                   WVPPLYLARGNYFSLSGRAPFAHLVYPVPDRAGLGVHLTLDLAGDARFGPDVEWIDALR
FT                   YDVDPRRAESFCTSIRAYWPGLPEGSLRPAYAGIRAKVSGPGEPAADFVIQGTAQHGVR
FT                   GLVNLFGIESPGLTAALAIAQRVGDMAARTRHT"
     MTIERIDCVV IGAGVVGLAI ARELAARGRE TLILEAADAI GTGMSSRNSE VIHAGLYYPR        60
     GSLKASLCLH GRDLLYDFCE THGVPHRRCG KLVVATSPAQ AKQLKAIAAR AEENGVLDLL       120
     TLSRDEVQAL EPELECLEAL FSPSTGIIDS HQLMLALLGD AERDGASCAL RSPVESIDAA       180
     GGRFVVRTGG EAPAAIAAAC VINSAGLDAQ ALAKRIRGLD SRWVPPLYLA RGNYFSLSGR       240
     APFAHLVYPV PDRAGLGVHL TLDLAGDARF GPDVEWIDAL RYDVDPRRAE SFCTSIRAYW       300
     PGLPEGSLRP AYAGIRAKVS GPGEPAADFV IQGTAQHGVR GLVNLFGIES PGLTAALAIA       360
     QRVGDMAART RHT                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page