(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE43

CP000124.PE43        Location/Qualifiers
FT   CDS             complement(51427..52293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0049"
FT                   /product="Pyridoxamine 5'-phosphate oxidase family"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48610"
FT                   /db_xref="GOA:Q3JY87"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY87"
FT                   /protein_id="ABA48610.1"
FT                   /translation="MRRQAHAWGRPIRVGPGRHGLAGHALPPGAPSHAACPGAAQRAAH
FT                   SRGDAADVSLPQARISHVNISAALPLHLLHRNVLGTLATHSRAPEGYPYPTVVPYAVDA
FT                   RHRPIVLVSGLAEHTRNLAADPRAGFLVVDGLGDAAGASDSVLEAERATLVGRFEPAGA
FT                   DPHVVARYLRYHPDGERYLALGDFTFWALACERLRYIGGFGRMGWLDATELDALAPVGY
FT                   DDERALWDEYGASRERRAGLELLGVDRYGADWRLNGLKRRTPFDAPKMDVESLLAALRE
FT                   AAAVSLM"
     MRRQAHAWGR PIRVGPGRHG LAGHALPPGA PSHAACPGAA QRAAHSRGDA ADVSLPQARI        60
     SHVNISAALP LHLLHRNVLG TLATHSRAPE GYPYPTVVPY AVDARHRPIV LVSGLAEHTR       120
     NLAADPRAGF LVVDGLGDAA GASDSVLEAE RATLVGRFEP AGADPHVVAR YLRYHPDGER       180
     YLALGDFTFW ALACERLRYI GGFGRMGWLD ATELDALAPV GYDDERALWD EYGASRERRA       240
     GLELLGVDRY GADWRLNGLK RRTPFDAPKM DVESLLAALR EAAAVSLM                    288
//

If you have problems or comments...

PBIL Back to PBIL home page