(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE437

CP000124.PE437       Location/Qualifiers
FT   CDS             complement(458120..459136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0446"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF06149"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49220"
FT                   /db_xref="GOA:Q3JX43"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX43"
FT                   /protein_id="ABA49220.1"
FT                   /translation="MTSCTRRAVPAARTIRRHGEGRRAPRPARQPAPSPGSGARARRTR
FT                   ARPAVPSGRQSREGPSARRPRADRKPPRAARRRRASTHVRRMFMQGTVSLWPLIGVAVI
FT                   VVGFALRFNPMLIVATAAIVTAASAHFPPERILAAIGAGFLKTRNIPLIILLPLAVIGL
FT                   LERHGLRERAQAWIASIRAATAGRLLILYLLVRELTAAVGLTGLGGHPQMVRPLIAPMA
FT                   EGATENRFGPLPDAIRHRLRAYAAATDNVGLFFGEDIFVAFGAIVLMVTFLKEAGIAVE
FT                   PMRVALWGIPTAVSAFVIHGARLWLLDRRLERELRASAAPHAASNGANAAADNGGRA"
     MTSCTRRAVP AARTIRRHGE GRRAPRPARQ PAPSPGSGAR ARRTRARPAV PSGRQSREGP        60
     SARRPRADRK PPRAARRRRA STHVRRMFMQ GTVSLWPLIG VAVIVVGFAL RFNPMLIVAT       120
     AAIVTAASAH FPPERILAAI GAGFLKTRNI PLIILLPLAV IGLLERHGLR ERAQAWIASI       180
     RAATAGRLLI LYLLVRELTA AVGLTGLGGH PQMVRPLIAP MAEGATENRF GPLPDAIRHR       240
     LRAYAAATDN VGLFFGEDIF VAFGAIVLMV TFLKEAGIAV EPMRVALWGI PTAVSAFVIH       300
     GARLWLLDRR LERELRASAA PHAASNGANA AADNGGRA                               338
//

If you have problems or comments...

PBIL Back to PBIL home page