(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE442

CP000124.PE442       Location/Qualifiers
FT   CDS             462902..463546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX38"
FT                   /protein_id="ABA49138.1"
FT                   /translation="MTARGDAPAAAALCGSIVRPIEPRLGDDPVERQIVRFARQLAHAA
FT                   RVVCDAHRHGRRRARPCGERAVVIAAAVAEPEAAVIEADARNQQQLRHEPRARRGLGNP
FT                   VAALAHRRIGRPRMEFERRAGLADHGQRGLPARVAGEPRRDRIARVEFARQRPVEADRA
FT                   RRALRENREHAPRERVVRARRALRVEAAPSKRFAQRALRIRRRGACYAFAH"
     MTARGDAPAA AALCGSIVRP IEPRLGDDPV ERQIVRFARQ LAHAARVVCD AHRHGRRRAR        60
     PCGERAVVIA AAVAEPEAAV IEADARNQQQ LRHEPRARRG LGNPVAALAH RRIGRPRMEF       120
     ERRAGLADHG QRGLPARVAG EPRRDRIARV EFARQRPVEA DRARRALREN REHAPRERVV       180
     RARRALRVEA APSKRFAQRA LRIRRRGACY AFAH                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page