(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE446

CP000124.PE446       Location/Qualifiers
FT   CDS             465642..466601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0455"
FT                   /product="predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF05368;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48768"
FT                   /db_xref="GOA:Q3JX34"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX34"
FT                   /protein_id="ABA48768.1"
FT                   /translation="MQGQTIAMLGGTGFIGSRLVNVLVGAGAHVRIGARRREHARHLAT
FT                   LPVDIVELSAFDVRELARFVAGAQAAVNLVGVLRGGHGKPYGEGFERLHVALPAALAAA
FT                   CIEARVPRMLHVSALGADPHAPSMYLRSKGDGEIALRAQAAAGALDVTIFRPSIVFGPG
FT                   DAFVNTFARLQRIFPVLPLAMPDALMQPVHVGDVAQAIANACVRDATRGWTYELGGPRT
FT                   YRLEEIVRYAGRLIGRPARIVRLPDALARLQARVFEMLPGEPLVSRDNLASLSVPSVMT
FT                   GPIAPELGIAPASLEHIAPTYVGDAALRSRFSDRRARR"
     MQGQTIAMLG GTGFIGSRLV NVLVGAGAHV RIGARRREHA RHLATLPVDI VELSAFDVRE        60
     LARFVAGAQA AVNLVGVLRG GHGKPYGEGF ERLHVALPAA LAAACIEARV PRMLHVSALG       120
     ADPHAPSMYL RSKGDGEIAL RAQAAAGALD VTIFRPSIVF GPGDAFVNTF ARLQRIFPVL       180
     PLAMPDALMQ PVHVGDVAQA IANACVRDAT RGWTYELGGP RTYRLEEIVR YAGRLIGRPA       240
     RIVRLPDALA RLQARVFEML PGEPLVSRDN LASLSVPSVM TGPIAPELGI APASLEHIAP       300
     TYVGDAALRS RFSDRRARR                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page