(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE45

CP000124.PE45        Location/Qualifiers
FT   CDS             complement(53819..54961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0051"
FT                   /product="putative extracellular ligand binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50497"
FT                   /db_xref="GOA:Q3JY85"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY85"
FT                   /protein_id="ABA50497.1"
FT                   /translation="MNIKMQKLLPISAAAMLLAAAATNAAADQVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKVTLQLDAQDDAADPRTATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   RSKGVKSVAVVDDSTAYGQGLANEFEKKAKALGLKVVSHDATNDKAVDFRAILTKIKGE
FT                   NPDAVMYGGMDATGGPFAKQAKQLGLRAKIFAGDGVCTEKLADLAGDATDNVVCSEAGA
FT                   SLEKMPGGAAFKAKYEKRFGQPIQIYAPFTYDAVYIIVDAMKRANSTDPAKIVAAMPKT
FT                   NYTGVIGTTTFDSKGDLQHGVISLYDYKGGKKTFLDEVKM"
     MNIKMQKLLP ISAAAMLLAA AATNAAADQV VKIGHVAPLT GGIAHLGKDN ENGARLAVEE        60
     INAKGLTIGG QKVTLQLDAQ DDAADPRTAT QVAQKLVDDK VVAVVGHLNS GTSIPASKIY       120
     SDAGIVQISP SATNPAYTQQ GFKTTYRVVA TDAQQGPALA NYARSKGVKS VAVVDDSTAY       180
     GQGLANEFEK KAKALGLKVV SHDATNDKAV DFRAILTKIK GENPDAVMYG GMDATGGPFA       240
     KQAKQLGLRA KIFAGDGVCT EKLADLAGDA TDNVVCSEAG ASLEKMPGGA AFKAKYEKRF       300
     GQPIQIYAPF TYDAVYIIVD AMKRANSTDP AKIVAAMPKT NYTGVIGTTT FDSKGDLQHG       360
     VISLYDYKGG KKTFLDEVKM                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page