(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE452

CP000124.PE452       Location/Qualifiers
FT   CDS             complement(470867..472396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0461"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA, putative"
FT                   /note="identified by match to protein family HMM PF03240"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49246"
FT                   /db_xref="GOA:Q3JX28"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX28"
FT                   /protein_id="ABA49246.1"
FT                   /translation="MTTDAGRATRTRFAVALALAGWMGAALAQQAGDGGMIVIPGRGES
FT                   AQTALANANAASARGANGAGAAGPGGADRTASPGGWHAPAAAQAAAAWSGRAGAASGAE
FT                   SAAESGDVRAATEPRTGLIVIEPGPAESNGRIPAAAPSGWHPSAAMPRAESNGGANPVP
FT                   PRTGSNRSAGSASASAGWTAPPGAASQGNPAANVAPAPRVSAASRAPATTDMQRVAPVI
FT                   AQDEGAAPAGRPANARAAAQSWPARDPSVAAGGVIPVSLRAQPAPRTLPVRSAPIRAAA
FT                   TSAAGAQPAAASATAAGAVPAAQQDGESIRRAALAFLQQQAAGLPGKTTVTVAPAFPRG
FT                   LAACTTLEPFLPSGARLWGRTTVGVRCAGERPWTIYLQAKLAVQATYYVAARQIAPGET
FT                   LTAADLVARDGDLTLLPLAVITDAQQAVGATALMRVAAGLPLRRDLLKSAASVSIGQTV
FT                   RVVASGQGFTISAEGSVLNNAAPGQQVRVRMAAGQIVTAIVKDAATVEIPL"
     MTTDAGRATR TRFAVALALA GWMGAALAQQ AGDGGMIVIP GRGESAQTAL ANANAASARG        60
     ANGAGAAGPG GADRTASPGG WHAPAAAQAA AAWSGRAGAA SGAESAAESG DVRAATEPRT       120
     GLIVIEPGPA ESNGRIPAAA PSGWHPSAAM PRAESNGGAN PVPPRTGSNR SAGSASASAG       180
     WTAPPGAASQ GNPAANVAPA PRVSAASRAP ATTDMQRVAP VIAQDEGAAP AGRPANARAA       240
     AQSWPARDPS VAAGGVIPVS LRAQPAPRTL PVRSAPIRAA ATSAAGAQPA AASATAAGAV       300
     PAAQQDGESI RRAALAFLQQ QAAGLPGKTT VTVAPAFPRG LAACTTLEPF LPSGARLWGR       360
     TTVGVRCAGE RPWTIYLQAK LAVQATYYVA ARQIAPGETL TAADLVARDG DLTLLPLAVI       420
     TDAQQAVGAT ALMRVAAGLP LRRDLLKSAA SVSIGQTVRV VASGQGFTIS AEGSVLNNAA       480
     PGQQVRVRMA AGQIVTAIVK DAATVEIPL                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page