(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE460

CP000124.PE460       Location/Qualifiers
FT   CDS             complement(478108..480336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50544"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX20"
FT                   /protein_id="ABA50544.1"
FT                   /translation="MYRTVARLASADLLHDRNQLLRVVRIGCVAGLLHSMREAFRVVAR
FT                   VQHARVARIVFQQVRVIGHRMLVRVVCAELRDHAVRLAVHVFGGDGRYRAAGPALRRLD
FT                   AEHVVARFAVRAADLALAPAGFERRLADDEARRNAGGRARRLRGERHLLDERIRLRGVA
FT                   VALQRRRERARRRIAARARERAVAWRPIRVRIRLRERVHRREAAFALRVGRDVRVAQQL
FT                   LGERVGHADALRRHLLRELLIEHRRVHLRRARIEQAVRRRRVAHALQHHLREHRVELAR
FT                   DHLHTLARRSRRGLRAQRVEPLNVEREALRQIVRFRESRHLDDLQVRAKRARRLHRLQD
FT                   RHQIRGRRAERVERLHHVGEVRARRHHPQRAIVLLELDLRLLRHHRLPVRERPRLRHHG
FT                   LRVDDDRQIAVRDRAVLQRHHLVHHDRARARVQDHLRRGPLRAHLEILQPRHERDLLRR
FT                   IGGRGELDRAAVERRRRARAEARVHRGHDALRGAVIHVVQLQLQHAVHLRDRVRHRALD
FT                   DRAAGDAAGRELVHLHAAAVRARARAAHRHVALRERVHLAVGALQRREQQRAAAQALRI
FT                   AERRYRHVDRLTRPRERRQRRRHHHRGDVLQLHVRHRRRAAAVGRAVVDRDAEVREHVR
FT                   ERLRRERRLHRLVARAVEADDEAVADQRVVAHALDLREVLQALRARRGGREREREHARG
FT                   ERAARRRPATRSNEGAHDAREQGTHRLHHGAMLRKKRCSQPIVSASLM"
     MYRTVARLAS ADLLHDRNQL LRVVRIGCVA GLLHSMREAF RVVARVQHAR VARIVFQQVR        60
     VIGHRMLVRV VCAELRDHAV RLAVHVFGGD GRYRAAGPAL RRLDAEHVVA RFAVRAADLA       120
     LAPAGFERRL ADDEARRNAG GRARRLRGER HLLDERIRLR GVAVALQRRR ERARRRIAAR       180
     ARERAVAWRP IRVRIRLRER VHRREAAFAL RVGRDVRVAQ QLLGERVGHA DALRRHLLRE       240
     LLIEHRRVHL RRARIEQAVR RRRVAHALQH HLREHRVELA RDHLHTLARR SRRGLRAQRV       300
     EPLNVEREAL RQIVRFRESR HLDDLQVRAK RARRLHRLQD RHQIRGRRAE RVERLHHVGE       360
     VRARRHHPQR AIVLLELDLR LLRHHRLPVR ERPRLRHHGL RVDDDRQIAV RDRAVLQRHH       420
     LVHHDRARAR VQDHLRRGPL RAHLEILQPR HERDLLRRIG GRGELDRAAV ERRRRARAEA       480
     RVHRGHDALR GAVIHVVQLQ LQHAVHLRDR VRHRALDDRA AGDAAGRELV HLHAAAVRAR       540
     ARAAHRHVAL RERVHLAVGA LQRREQQRAA AQALRIAERR YRHVDRLTRP RERRQRRRHH       600
     HRGDVLQLHV RHRRRAAAVG RAVVDRDAEV REHVRERLRR ERRLHRLVAR AVEADDEAVA       660
     DQRVVAHALD LREVLQALRA RRGGRERERE HARGERAARR RPATRSNEGA HDAREQGTHR       720
     LHHGAMLRKK RCSQPIVSAS LM                                                742
//

If you have problems or comments...

PBIL Back to PBIL home page