(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE472

CP000124.PE472       Location/Qualifiers
FT   CDS             complement(489067..489405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50603"
FT                   /db_xref="GOA:Q3JX08"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX08"
FT                   /protein_id="ABA50603.1"
FT                   /translation="MTAAKFFLRYTLVPFVAIVLVVVWAFNRESDEIDARQYAALVAAY
FT                   PGFTPDLRDEVNRAMRDGKLAKSDYASIVRDSLNHGYVLDWSSTNVDLNAERGKLLGLV
FT                   KSDAHAPD"
     MTAAKFFLRY TLVPFVAIVL VVVWAFNRES DEIDARQYAA LVAAYPGFTP DLRDEVNRAM        60
     RDGKLAKSDY ASIVRDSLNH GYVLDWSSTN VDLNAERGKL LGLVKSDAHA PD               112
//

If you have problems or comments...

PBIL Back to PBIL home page