(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE474

CP000124.PE474       Location/Qualifiers
FT   CDS             489881..490621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0483"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49344"
FT                   /db_xref="GOA:Q3JX06"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX06"
FT                   /protein_id="ABA49344.1"
FT                   /translation="MNLDAASRNLTVASLLTLSGGYLDAYTYVGHGHVFANTMTGNVAL
FT                   LGINVSAGDWAQALHHVPPLAGFVIAVFVAHTLGLAAQKGWVRHTAFISLIVEIGFLAF
FT                   ASAGWPAMSSAWLIPGISFVATLQTLSFTHLENLSYTSVMTTGNLRRAAQLLFAGLIPR
FT                   YDALALHDSGLLAVISLCFLMGAVAGGFVTRLVGDGALWGAVLLLAAAFAEIVRRARHD
FT                   SGAGAARAERAARDAPAERAAHER"
     MNLDAASRNL TVASLLTLSG GYLDAYTYVG HGHVFANTMT GNVALLGINV SAGDWAQALH        60
     HVPPLAGFVI AVFVAHTLGL AAQKGWVRHT AFISLIVEIG FLAFASAGWP AMSSAWLIPG       120
     ISFVATLQTL SFTHLENLSY TSVMTTGNLR RAAQLLFAGL IPRYDALALH DSGLLAVISL       180
     CFLMGAVAGG FVTRLVGDGA LWGAVLLLAA AFAEIVRRAR HDSGAGAARA ERAARDAPAE       240
     RAAHER                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page