(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE478

CP000124.PE478       Location/Qualifiers
FT   CDS             complement(494253..495281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0487"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50155"
FT                   /db_xref="GOA:Q3JX02"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX02"
FT                   /protein_id="ABA50155.1"
FT                   /translation="MQNEPQRTRSDAHTPRLIKHAGRIAALAGLAISLWLVARDDPHTV
FT                   LALLRAAGIGLVVAAASHLLPMLANAKDWQTLIAPRCRPSLPAMLRLVWIRESVNGLLP
FT                   VARIGGEFASFRLLRAHGLTAPAAVASLVSDMQLTLISQALFALAGVGYLLVHATSDTA
FT                   RVAGMFAWGLAVLAPLLLLFALVQHAKPFERAMHALNRVAGGQLASLVERSAQIDDALK
FT                   AVWRQRGTVVRYLFFWQPLQHLATSLEIWLALHFLGASVSLVDALVIEALIQALSSAAF
FT                   FVPGGLGVQEGGFVLIGGALGLDPATSLGLAGARRIRDLLIFVPGLLAWQHAEASVAAS
FT                   AP"
     MQNEPQRTRS DAHTPRLIKH AGRIAALAGL AISLWLVARD DPHTVLALLR AAGIGLVVAA        60
     ASHLLPMLAN AKDWQTLIAP RCRPSLPAML RLVWIRESVN GLLPVARIGG EFASFRLLRA       120
     HGLTAPAAVA SLVSDMQLTL ISQALFALAG VGYLLVHATS DTARVAGMFA WGLAVLAPLL       180
     LLFALVQHAK PFERAMHALN RVAGGQLASL VERSAQIDDA LKAVWRQRGT VVRYLFFWQP       240
     LQHLATSLEI WLALHFLGAS VSLVDALVIE ALIQALSSAA FFVPGGLGVQ EGGFVLIGGA       300
     LGLDPATSLG LAGARRIRDL LIFVPGLLAW QHAEASVAAS AP                          342
//

If you have problems or comments...

PBIL Back to PBIL home page