(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE479

CP000124.PE479       Location/Qualifiers
FT   CDS             complement(495316..496563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0488"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.80"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50942"
FT                   /db_xref="GOA:Q3JX01"
FT                   /db_xref="InterPro:IPR017835"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX01"
FT                   /protein_id="ABA50942.1"
FT                   /translation="MKALAWLTGAVLALLAAELISFGDIGRFVTLLAALLAAPCALAAA
FT                   FGCVYTLVAAALTHRFFARAPREPHACPPVTIVKPLHGVERTLFANLASFCEQRYDGPI
FT                   QFLFGVHDRDDPALRAVDALRTAFPRAHVTIVADARLYGPNRKIANLVNMLPAAAHDVL
FT                   IFADSDVSVGPDYVRHIVGELGEPGVGLVTCVYRGRPDPGFWPRVEALVTSHQFLPGVV
FT                   TGLALKLARPCFGQTIAMRRAMLDAIGGLAQFAHHLAEDHAIGEAVRARGARVVVPPFA
FT                   VEHGCVETRVAQLVEHELRWSRTIRAVDPRGHLGSLLTHPLALALLAGVLSSGAAWAWP
FT                   LVPAALVARVAAKRIVDRATKRPVRDLWLLPLADLIAFGIFVASFSSSRVIWRGFSFDV
FT                   DRDGRLCPTPEKRPNA"
     MKALAWLTGA VLALLAAELI SFGDIGRFVT LLAALLAAPC ALAAAFGCVY TLVAAALTHR        60
     FFARAPREPH ACPPVTIVKP LHGVERTLFA NLASFCEQRY DGPIQFLFGV HDRDDPALRA       120
     VDALRTAFPR AHVTIVADAR LYGPNRKIAN LVNMLPAAAH DVLIFADSDV SVGPDYVRHI       180
     VGELGEPGVG LVTCVYRGRP DPGFWPRVEA LVTSHQFLPG VVTGLALKLA RPCFGQTIAM       240
     RRAMLDAIGG LAQFAHHLAE DHAIGEAVRA RGARVVVPPF AVEHGCVETR VAQLVEHELR       300
     WSRTIRAVDP RGHLGSLLTH PLALALLAGV LSSGAAWAWP LVPAALVARV AAKRIVDRAT       360
     KRPVRDLWLL PLADLIAFGI FVASFSSSRV IWRGFSFDVD RDGRLCPTPE KRPNA            415
//

If you have problems or comments...

PBIL Back to PBIL home page