(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE483

CP000124.PE483       Location/Qualifiers
FT   CDS             499879..500019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49846"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ7"
FT                   /protein_id="ABA49846.1"
FT                   /translation="MQFGLLLSQLPHVDESRVHYDAMLSLKAAGEPASASFWQRLKALI
FT                   S"
     MQFGLLLSQL PHVDESRVHY DAMLSLKAAG EPASASFWQR LKALIS                       46
//

If you have problems or comments...

PBIL Back to PBIL home page