(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE489

CP000124.PE489       Location/Qualifiers
FT   CDS             complement(504088..505611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48398"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWZ1"
FT                   /protein_id="ABA48398.1"
FT                   /translation="MIRADFHARTGESRRPGGLSRRLPAYRARRNRPFVAPVITPAVAH
FT                   RANRASCVVRLLLPQRDELLGRGWMDADRLVELRLRRARPDRDRDALDDLRRVAPDHVR
FT                   ADDALAVARDDELHERLFVAAGQRVPQRAERRLVDVERAELGARLRLGEPDRRDLRLAE
FT                   HRGRNVAMIGGDPLAAEQVRREQHAVARRDGRQLRARGDVADRVDRRHRRRRIGVDFDR
FT                   AVRVARDPDRLEPEPVAIRDAPRRIQHRVVRPVRALGEPERQPAVGAALDRLDRRARMD
FT                   GDTLLRHLAMQRVPHVVVEAAQDLLAAIEQVDIDAEPVEDARELDRDVAAADDRDPLRQ
FT                   LGQLERLARRDRVLDAGNRRQHRPRACRDGDVPGGDTPARDVDRMRADERRAPRMDLDA
FT                   RLVQQIDVDTAQARDLAVLRLDERRPRKQADVEGPAIARGVLDIVAVMRRVDEQLFRDA
FT                   AAQHAGAADALFLGDADARAVGRRDAAQAHAARARADDKEIVVEFHSVV"
     MIRADFHART GESRRPGGLS RRLPAYRARR NRPFVAPVIT PAVAHRANRA SCVVRLLLPQ        60
     RDELLGRGWM DADRLVELRL RRARPDRDRD ALDDLRRVAP DHVRADDALA VARDDELHER       120
     LFVAAGQRVP QRAERRLVDV ERAELGARLR LGEPDRRDLR LAEHRGRNVA MIGGDPLAAE       180
     QVRREQHAVA RRDGRQLRAR GDVADRVDRR HRRRRIGVDF DRAVRVARDP DRLEPEPVAI       240
     RDAPRRIQHR VVRPVRALGE PERQPAVGAA LDRLDRRARM DGDTLLRHLA MQRVPHVVVE       300
     AAQDLLAAIE QVDIDAEPVE DARELDRDVA AADDRDPLRQ LGQLERLARR DRVLDAGNRR       360
     QHRPRACRDG DVPGGDTPAR DVDRMRADER RAPRMDLDAR LVQQIDVDTA QARDLAVLRL       420
     DERRPRKQAD VEGPAIARGV LDIVAVMRRV DEQLFRDAAA QHAGAADALF LGDADARAVG       480
     RRDAAQAHAA RARADDKEIV VEFHSVV                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page