(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE491

CP000124.PE491       Location/Qualifiers
FT   CDS             complement(505775..507493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY9"
FT                   /protein_id="ABA47881.1"
FT                   /translation="MRRGRPPPSCRPSGSRRRGPGTARTPGHPRAGASVAALVFLQLRQ
FT                   RRRFARRQQADLRIDAQLVARIGDVEVAHRQLADPVARREHRLHLLHRQALRLVREVGR
FT                   ARADDRIIVAAAQLDRHLARDRARDPALRRLAQHDRLRVEPAALVQQAAETTAVLAVLL
FT                   DRVLVVDAGDEALVCDVQQREPRGLIDAAALRLDDPVLDLVAHPEAVAPADPVRLEQQR
FT                   DRILVLDAVQRDRAPLFEADRHFFLVDLHVVAPERDAHDRIDDLDAALEALEILRLVRR
FT                   AEQVRIGRVRLLGRHLVLETGLAHEFGHFRAAAELVDELLVEPRLVDLQIRIDEQAIAV
FT                   EALDVVALVRAAVAPDVDAVFLHRGNEHRARHGAANRGRIEIRDAGRRNVERAALERRD
FT                   PFGDELRAAVDQARAFGAVLDRALRDRVVVVFVGLAEIGRVCVRNGSLDAHPVQRGARV
FT                   EAAGERNADLLAGREIFKNRGHDENRSISWKGEFRGIQEYRLCPIMRQVSRAAPAGPKW
FT                   GREGGGRGCGVDGGGVWGSRGGQGGRQSRARQARRTSRGDWIKESGARIVGPLGH"
     MRRGRPPPSC RPSGSRRRGP GTARTPGHPR AGASVAALVF LQLRQRRRFA RRQQADLRID        60
     AQLVARIGDV EVAHRQLADP VARREHRLHL LHRQALRLVR EVGRARADDR IIVAAAQLDR       120
     HLARDRARDP ALRRLAQHDR LRVEPAALVQ QAAETTAVLA VLLDRVLVVD AGDEALVCDV       180
     QQREPRGLID AAALRLDDPV LDLVAHPEAV APADPVRLEQ QRDRILVLDA VQRDRAPLFE       240
     ADRHFFLVDL HVVAPERDAH DRIDDLDAAL EALEILRLVR RAEQVRIGRV RLLGRHLVLE       300
     TGLAHEFGHF RAAAELVDEL LVEPRLVDLQ IRIDEQAIAV EALDVVALVR AAVAPDVDAV       360
     FLHRGNEHRA RHGAANRGRI EIRDAGRRNV ERAALERRDP FGDELRAAVD QARAFGAVLD       420
     RALRDRVVVV FVGLAEIGRV CVRNGSLDAH PVQRGARVEA AGERNADLLA GREIFKNRGH       480
     DENRSISWKG EFRGIQEYRL CPIMRQVSRA APAGPKWGRE GGGRGCGVDG GGVWGSRGGQ       540
     GGRQSRARQA RRTSRGDWIK ESGARIVGPL GH                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page