(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE495

CP000124.PE495       Location/Qualifiers
FT   CDS             509241..509576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0504"
FT                   /product="putative cheavy metal binding protein"
FT                   /note="identified by match to protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47700"
FT                   /db_xref="GOA:Q3JWY5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY5"
FT                   /protein_id="ABA47700.1"
FT                   /translation="MGTLAFDASCRAALTAAQPIQPPALDLPTVGRSILQSIHIDWRGN
FT                   MKLEVKDMSCGGCANAITQAIQTADSSARVSVDVASKVVDVGSALGIERVVAIIEAAGF
FT                   HPAVLAA"
     MGTLAFDASC RAALTAAQPI QPPALDLPTV GRSILQSIHI DWRGNMKLEV KDMSCGGCAN        60
     AITQAIQTAD SSARVSVDVA SKVVDVGSAL GIERVVAIIE AAGFHPAVLA A                111
//

If you have problems or comments...

PBIL Back to PBIL home page