(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE499

CP000124.PE499       Location/Qualifiers
FT   CDS             513216..513890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0508"
FT                   /product="LemA family protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50865"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY1"
FT                   /protein_id="ABA50865.1"
FT                   /translation="MRFHSSAPRAAATWIRLIRAALLAAFALTLSGCGYNAIQVQDEQV
FT                   KASWSEVLNQYQRRADLVPNLVNTVKGYANQERDVLTRVTEARAQVGSIRATPELLSDP
FT                   QAFAKFDAAQGQLTSSLSRLLVVSENYPQLKSDANFRDLQAQLEGTENRITVARNRYIR
FT                   SVQAYNTTIRSFPSNLTAMAFGYKEKPNFSVENEAQIAKPPRVDFGTSSAPAPAPAAGA
FT                   SN"
     MRFHSSAPRA AATWIRLIRA ALLAAFALTL SGCGYNAIQV QDEQVKASWS EVLNQYQRRA        60
     DLVPNLVNTV KGYANQERDV LTRVTEARAQ VGSIRATPEL LSDPQAFAKF DAAQGQLTSS       120
     LSRLLVVSEN YPQLKSDANF RDLQAQLEGT ENRITVARNR YIRSVQAYNT TIRSFPSNLT       180
     AMAFGYKEKP NFSVENEAQI AKPPRVDFGT SSAPAPAPAA GASN                        224
//

If you have problems or comments...

PBIL Back to PBIL home page