(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE50

CP000124.PE50        Location/Qualifiers
FT   CDS             complement(60153..60506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0056"
FT                   /product="YvlD"
FT                   /note="identified by match to protein family HMM PF04020"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47859"
FT                   /db_xref="GOA:Q3JY80"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY80"
FT                   /protein_id="ABA47859.1"
FT                   /translation="MTVILTWIINALALLIITYLVPSIHIKSFGTALIVAVVLGLINAV
FT                   IRPVLILLTLPVTIVTLGLFILVVNALCFWFASSLLKGFEVSGFWSAFFGSILYSIVSW
FT                   LLSALIFGQRNIG"
     MTVILTWIIN ALALLIITYL VPSIHIKSFG TALIVAVVLG LINAVIRPVL ILLTLPVTIV        60
     TLGLFILVVN ALCFWFASSL LKGFEVSGFW SAFFGSILYS IVSWLLSALI FGQRNIG          117
//

If you have problems or comments...

PBIL Back to PBIL home page