(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE501

CP000124.PE501       Location/Qualifiers
FT   CDS             514735..515232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04536"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49720"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX9"
FT                   /protein_id="ABA49720.1"
FT                   /translation="MDIARIARHLSMTRWRVAAAFPRRTLGKIERAIEASHEKHVGQLR
FT                   FAVEGALHASMLLRGITARERAIDVFSELRVWDTEHNNGVLIYLLLADHDVEIVADRGI
FT                   HARVDGDEWERVCRAMEAQFRRGRFEAGSIHGIEAVTALLARHYPSRRAPGDALPSTPV
FT                   VL"
     MDIARIARHL SMTRWRVAAA FPRRTLGKIE RAIEASHEKH VGQLRFAVEG ALHASMLLRG        60
     ITARERAIDV FSELRVWDTE HNNGVLIYLL LADHDVEIVA DRGIHARVDG DEWERVCRAM       120
     EAQFRRGRFE AGSIHGIEAV TALLARHYPS RRAPGDALPS TPVVL                       165
//

If you have problems or comments...

PBIL Back to PBIL home page