(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE502

CP000124.PE502       Location/Qualifiers
FT   CDS             515266..515733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48422"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX8"
FT                   /protein_id="ABA48422.1"
FT                   /translation="MRAATCNPIASNIARRTANHGYFAALYSCAMKIVRLLLVLLWCAT
FT                   LPLTGLAASGLAGDCPMQQAMSMSEDGAMPSMQDCESMRSSVAGKSGKAGKAANVFCKV
FT                   MVQCQFGSLYHPMPAADVARPASPGRPLVFHYAKSLTVREPGGLWRPPRTA"
     MRAATCNPIA SNIARRTANH GYFAALYSCA MKIVRLLLVL LWCATLPLTG LAASGLAGDC        60
     PMQQAMSMSE DGAMPSMQDC ESMRSSVAGK SGKAGKAANV FCKVMVQCQF GSLYHPMPAA       120
     DVARPASPGR PLVFHYAKSL TVREPGGLWR PPRTA                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page