(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE507

CP000124.PE507       Location/Qualifiers
FT   CDS             522298..522909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0516"
FT                   /product="avidin family protein"
FT                   /note="identified by match to protein family HMM PF01382"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48484"
FT                   /db_xref="GOA:Q3JWX3"
FT                   /db_xref="InterPro:IPR005468"
FT                   /db_xref="InterPro:IPR036896"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX3"
FT                   /protein_id="ABA48484.1"
FT                   /translation="MPRDARAARASARDASVAQRVPRGRRRDSRRKVARRRMRCTIVLG
FT                   IRAASPIKEALARPAPRPGRLPSIHRSGRRNMQRLEHVLRRVKAGTGAPIDFSGTWKNE
FT                   LGSTMRIEQSGDSVSGTYESAVSENGGATSGQLSGYVDGDLIAFVVHWDQFQAITAWVG
FT                   QGGPGASSDRINTLWQMTQQVEAGEEWASINAGADIFVKT"
     MPRDARAARA SARDASVAQR VPRGRRRDSR RKVARRRMRC TIVLGIRAAS PIKEALARPA        60
     PRPGRLPSIH RSGRRNMQRL EHVLRRVKAG TGAPIDFSGT WKNELGSTMR IEQSGDSVSG       120
     TYESAVSENG GATSGQLSGY VDGDLIAFVV HWDQFQAITA WVGQGGPGAS SDRINTLWQM       180
     TQQVEAGEEW ASINAGADIF VKT                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page