(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE513

CP000124.PE513       Location/Qualifiers
FT   CDS             528327..529274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50793"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW7"
FT                   /protein_id="ABA50793.1"
FT                   /translation="MLAAVDGQRRARHAGRIREIARGVGDVVRARRAPADEPDDAYLRR
FT                   ERERLRRRRAMQRGLRERVRQPLGRRMKQRFVEQMNHDRTLAFVVARGVGRRVGERARE
FT                   HERRGDAARHRARERRVADVARGVRDGRGLRDHAGRPAERRAAIGDEPRDVRFDRQIGG
FT                   EHRRAAAERLDFGGERGGRAGFVARRGRERDVPAAPREADGERAADGRGVRRGPRGRRR
FT                   ARRLRLLLAGARGMCRRTGWRRCAGLRIARPAGADGLPRARPRRLGGARWRGARLHGAR
FT                   NQHDPRGAGRGCVAGVGWDGHLQCRDESESSRTR"
     MLAAVDGQRR ARHAGRIREI ARGVGDVVRA RRAPADEPDD AYLRRERERL RRRRAMQRGL        60
     RERVRQPLGR RMKQRFVEQM NHDRTLAFVV ARGVGRRVGE RAREHERRGD AARHRARERR       120
     VADVARGVRD GRGLRDHAGR PAERRAAIGD EPRDVRFDRQ IGGEHRRAAA ERLDFGGERG       180
     GRAGFVARRG RERDVPAAPR EADGERAADG RGVRRGPRGR RRARRLRLLL AGARGMCRRT       240
     GWRRCAGLRI ARPAGADGLP RARPRRLGGA RWRGARLHGA RNQHDPRGAG RGCVAGVGWD       300
     GHLQCRDESE SSRTR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page