(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE516

CP000124.PE516       Location/Qualifiers
FT   CDS             complement(530937..532394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWW4"
FT                   /protein_id="ABA50853.1"
FT                   /translation="MEARDERRISAIRIGGRHSHRHGAHRRRALDLAPGRRGLERRARG
FT                   RAARRAERVRGRGGPRLLLRRAVARKRGGRPRSALPAARRACAAPRDRPRDAAPRVFLH
FT                   RREQRRSRLRSAAAARRLARAREVGAFRLHQPRARAARVDARRARRRAARSGREDQLRS
FT                   ELPESDDGQLPADAREDGRTRRSDQGVRRRSAPPVRGRRRSERDRAAARAQPARGAARH
FT                   ARAGHGDALRGRRDDRRTAAAHRGSRYGRRGRRDDRRPAVQPDDGAGARLARASVVRAR
FT                   GGRGGVPAHGRARADARRSRRARRGVTYAPAGAGAETFRAWNARRGDSRRVGGCLQRVP
FT                   EEDSPIGRAPADERTPPASHRAARCMPEAPAPIPGAAMRGPLELAHRAFLPPLKAGRRN
FT                   ATMGASFLGRGIMDGGNTYTKGLYTAKAHTRKTDNGRFQGYVILSRDEGGAPENTLYEV
FT                   EATSANEAEAFDEAKALAHRILGDLEL"
     MEARDERRIS AIRIGGRHSH RHGAHRRRAL DLAPGRRGLE RRARGRAARR AERVRGRGGP        60
     RLLLRRAVAR KRGGRPRSAL PAARRACAAP RDRPRDAAPR VFLHRREQRR SRLRSAAAAR       120
     RLARAREVGA FRLHQPRARA ARVDARRARR RAARSGREDQ LRSELPESDD GQLPADARED       180
     GRTRRSDQGV RRRSAPPVRG RRRSERDRAA ARAQPARGAA RHARAGHGDA LRGRRDDRRT       240
     AAAHRGSRYG RRGRRDDRRP AVQPDDGAGA RLARASVVRA RGGRGGVPAH GRARADARRS       300
     RRARRGVTYA PAGAGAETFR AWNARRGDSR RVGGCLQRVP EEDSPIGRAP ADERTPPASH       360
     RAARCMPEAP APIPGAAMRG PLELAHRAFL PPLKAGRRNA TMGASFLGRG IMDGGNTYTK       420
     GLYTAKAHTR KTDNGRFQGY VILSRDEGGA PENTLYEVEA TSANEAEAFD EAKALAHRIL       480
     GDLEL                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page