(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE527

CP000124.PE527       Location/Qualifiers
FT   CDS             complement(542124..543083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0536"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47592"
FT                   /db_xref="GOA:Q3JWV3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWV3"
FT                   /protein_id="ABA47592.1"
FT                   /translation="MALPAVLQNLALPVIASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQLQTQLAEHKAANPDAVIGPIAVNQIVHQSNVRLEQDIRVCVEHKVPI
FT                   FITSLRAPAREIVDAVHGYGGIVLHDVINLRHAQKALEAGVDGLILVAAGAGGHAGTTS
FT                   PFALVGEVRRIFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATQEAHAVDAYKR
FT                   AILEAKSADIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKTKMNFGGDKAKAWKDI
FT                   WGAGQGVGLMDDVPSVAELVARLKREYDDAKARLGIRA"
     MALPAVLQNL ALPVIASPMF IVSYPELVLA QCKAGIVGSF PALNARPAEL LDEWLTQLQT        60
     QLAEHKAANP DAVIGPIAVN QIVHQSNVRL EQDIRVCVEH KVPIFITSLR APAREIVDAV       120
     HGYGGIVLHD VINLRHAQKA LEAGVDGLIL VAAGAGGHAG TTSPFALVGE VRRIFDGPIV       180
     LSGSIANGGS ILAAQAMGAD LAYMGTRFIA TQEAHAVDAY KRAILEAKSA DIIYTNLFTG       240
     VHGNYIRESI VNAGLDPDAL PESDKTKMNF GGDKAKAWKD IWGAGQGVGL MDDVPSVAEL       300
     VARLKREYDD AKARLGIRA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page