(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE53

CP000124.PE53        Location/Qualifiers
FT   CDS             62511..64133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY77"
FT                   /protein_id="ABA47901.1"
FT                   /translation="MQLAHARLAHLEHRADLAQVQPALVVQRHQQLLALRQALDRIDER
FT                   AAQMLVEQRRQRIAVIGAVAVEKRLVVGRAVEVLVVDELAAVQILQHRLVFVERHLQVR
FT                   GDLRLVRRAAEPLLDLMHRMFDFARGLAQAARQPIVAAQLVEHRAADALRRVGLELRAL
FT                   IFLVAARRVEQADHARLDQIVEVHARRHLRDELQAETTHERRVLRQHFVLGNLALSVIH
FT                   HAPSSSWRSGGMSRAAFKRRTSRPDPADARTRTHRPIQQIGGDLPVVARRRRRRERVHH
FT                   RVREPARALDQRIGGDATCVRQRHAQIPARDAREVLVGGSRVGRALHVVGQHAKLRARV
FT                   RVVQPLHARVRLGDRRGRHARDHEHVVRVARERGERAVRVELRVDQHDVRRAVAERVEL
FT                   RVAVADAREPRRLAHREAELVPHRLAVAQPRAAQRRRDRADVRALVDDEHVLAERGERR
FT                   GEIGDRRRAADARRPARHRDDARRASGEQAPQPFGLIGDALIQSGPRAVRCRCACSTRT
FT                   ASPAGHRHGARTANPRAARRTRS"
     MQLAHARLAH LEHRADLAQV QPALVVQRHQ QLLALRQALD RIDERAAQML VEQRRQRIAV        60
     IGAVAVEKRL VVGRAVEVLV VDELAAVQIL QHRLVFVERH LQVRGDLRLV RRAAEPLLDL       120
     MHRMFDFARG LAQAARQPIV AAQLVEHRAA DALRRVGLEL RALIFLVAAR RVEQADHARL       180
     DQIVEVHARR HLRDELQAET THERRVLRQH FVLGNLALSV IHHAPSSSWR SGGMSRAAFK       240
     RRTSRPDPAD ARTRTHRPIQ QIGGDLPVVA RRRRRRERVH HRVREPARAL DQRIGGDATC       300
     VRQRHAQIPA RDAREVLVGG SRVGRALHVV GQHAKLRARV RVVQPLHARV RLGDRRGRHA       360
     RDHEHVVRVA RERGERAVRV ELRVDQHDVR RAVAERVELR VAVADAREPR RLAHREAELV       420
     PHRLAVAQPR AAQRRRDRAD VRALVDDEHV LAERGERRGE IGDRRRAADA RRPARHRDDA       480
     RRASGEQAPQ PFGLIGDALI QSGPRAVRCR CACSTRTASP AGHRHGARTA NPRAARRTRS       540
//

If you have problems or comments...

PBIL Back to PBIL home page