(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE532

CP000124.PE532       Location/Qualifiers
FT   CDS             complement(546184..546342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06945"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49374"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU8"
FT                   /protein_id="ABA49374.1"
FT                   /translation="MPSPCTNVCRIDARTGWCEGCRRTRDEIAAWRKLDDDAKRTVLAR
FT                   IATRRAA"
     MPSPCTNVCR IDARTGWCEG CRRTRDEIAA WRKLDDDAKR TVLARIATRR AA                52
//

If you have problems or comments...

PBIL Back to PBIL home page