(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE536

CP000124.PE536       Location/Qualifiers
FT   CDS             complement(549042..549479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0545"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49642"
FT                   /db_xref="GOA:Q3JWU4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU4"
FT                   /protein_id="ABA49642.1"
FT                   /translation="MSATPRGALRPFHLAFPVTSLEHARRFYGGLLGCPEGRSSDHWVD
FT                   FDFFGHQLVAHLAPGETGRSAVNPVDGDDVPVRHFGVVLSMDEWHALADTLKAAGTRFV
FT                   IEPHIRFKGEAGEQATMFFVDPCGNALEFKAFADIGQLFAK"
     MSATPRGALR PFHLAFPVTS LEHARRFYGG LLGCPEGRSS DHWVDFDFFG HQLVAHLAPG        60
     ETGRSAVNPV DGDDVPVRHF GVVLSMDEWH ALADTLKAAG TRFVIEPHIR FKGEAGEQAT       120
     MFFVDPCGNA LEFKAFADIG QLFAK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page