(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE537

CP000124.PE537       Location/Qualifiers
FT   CDS             549629..550258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0546"
FT                   /product="Predicted esterase of the alpha/beta hydrolase
FT                   fold"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48609"
FT                   /db_xref="GOA:Q3JWU3"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU3"
FT                   /protein_id="ABA48609.1"
FT                   /translation="MRSCSKSTWPPRLVTAPGLHGSEGAHWQTWLERQFARALRVEQDD
FT                   WDAPHVERWAQKVRDLLARERGPFVIAAHSFGCLATAHALAQAAQTRAADVVGVLFVAP
FT                   ANPRKFAFAGDFDARRLNVPSIVVGSESDPWMTLADAREFAQRLGSAFVNLGDAGHINT
FT                   AAGYGPWPRAKYFVDTLVHCAAPLRLRDDDAPASGAPARQPLVTAA"
     MRSCSKSTWP PRLVTAPGLH GSEGAHWQTW LERQFARALR VEQDDWDAPH VERWAQKVRD        60
     LLARERGPFV IAAHSFGCLA TAHALAQAAQ TRAADVVGVL FVAPANPRKF AFAGDFDARR       120
     LNVPSIVVGS ESDPWMTLAD AREFAQRLGS AFVNLGDAGH INTAAGYGPW PRAKYFVDTL       180
     VHCAAPLRLR DDDAPASGAP ARQPLVTAA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page