(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE539

CP000124.PE539       Location/Qualifiers
FT   CDS             550738..550845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47811"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWU1"
FT                   /protein_id="ABA47811.1"
FT                   /translation="MPRCVPSKPGGAAGLPVRRPAVQTVAAAGAAVFSP"
     MPRCVPSKPG GAAGLPVRRP AVQTVAAAGA AVFSP                                   35
//

If you have problems or comments...

PBIL Back to PBIL home page