(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE544

CP000124.PE544       Location/Qualifiers
FT   CDS             554801..555973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0554"
FT                   /product="Lactonase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49908"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT6"
FT                   /protein_id="ABA49908.1"
FT                   /translation="MPASSRPSSAESRHDRCPDAAHDRADGLVHLPEPDSRLRRAAQPH
FT                   AEPAHDVGDGERAGMRAGVGDRAGVRVRQAGQSARARHHAARRNPPVDPADRDHRHRVD
FT                   RRAAPSARSMTNVDACGHAAADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSL
FT                   GCVRMWRTFPQTLAACAGRRVIAYDRLGFGQSDPRTDALGFDFVRDEARRCFPMLRDAF
FT                   GFDRFVAFGHSVGGGMAVHCAAEFASACDALITESAQAFVEDRTRAGIVDAREQFKQRD
FT                   AFERLRAYHGEKARWVLDAWIDTWLSPEFAGWSLASVLPRVTCPMLAIHGGDDEYGSAL
FT                   HPETIARLASGPAQIEILPGVRHVPHREREQWVAQRVAAFIGAGPHGVAE"
     MPASSRPSSA ESRHDRCPDA AHDRADGLVH LPEPDSRLRR AAQPHAEPAH DVGDGERAGM        60
     RAGVGDRAGV RVRQAGQSAR ARHHAARRNP PVDPADRDHR HRVDRRAAPS ARSMTNVDAC       120
     GHAAADRWVD TGRGRLFARC WPAPHRAHMP DDAPPIVLLH DSLGCVRMWR TFPQTLAACA       180
     GRRVIAYDRL GFGQSDPRTD ALGFDFVRDE ARRCFPMLRD AFGFDRFVAF GHSVGGGMAV       240
     HCAAEFASAC DALITESAQA FVEDRTRAGI VDAREQFKQR DAFERLRAYH GEKARWVLDA       300
     WIDTWLSPEF AGWSLASVLP RVTCPMLAIH GGDDEYGSAL HPETIARLAS GPAQIEILPG       360
     VRHVPHRERE QWVAQRVAAF IGAGPHGVAE                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page