(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE549

CP000124.PE549       Location/Qualifiers
FT   CDS             563745..564302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49335"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWT1"
FT                   /protein_id="ABA49335.1"
FT                   /translation="MAELVLASSSQEIRVLVVIDTAYIRSLNITPSKDPLQPTGIGHDH
FT                   QYLLCTGSRGIISGQGTGDLEFRANVGDYVAFTGTSIQDNSDDAVIVYDIKHYSGDKVF
FT                   NPFSANIITRKGAVEPNPDTPSRNGLPPRHTPINFATFDSKVARSGREGFGIAFGLYTL
FT                   QSNGQDQDLYGYYWWDPYITVA"
     MAELVLASSS QEIRVLVVID TAYIRSLNIT PSKDPLQPTG IGHDHQYLLC TGSRGIISGQ        60
     GTGDLEFRAN VGDYVAFTGT SIQDNSDDAV IVYDIKHYSG DKVFNPFSAN IITRKGAVEP       120
     NPDTPSRNGL PPRHTPINFA TFDSKVARSG REGFGIAFGL YTLQSNGQDQ DLYGYYWWDP       180
     YITVA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page