(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE557

CP000124.PE557       Location/Qualifiers
FT   CDS             578340..578858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51014"
FT                   /db_xref="GOA:Q3JWS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS3"
FT                   /protein_id="ABA51014.1"
FT                   /translation="MPHSRGRARMPGRRCILRTRGRECAEDRGAGPAPRDPAIGATRRR
FT                   IMKRPLSLTVLAWFVIVSNVIGLISMPFSLRDPNAVALLRYSPLPLEATVAIAVVSEGL
FT                   HLVAGTAILKRRIWGRTLYAIVALAGFAISVFTTPFKGMLIIAAALIALFLFILYRPAA
FT                   TAYFRQRAS"
     MPHSRGRARM PGRRCILRTR GRECAEDRGA GPAPRDPAIG ATRRRIMKRP LSLTVLAWFV        60
     IVSNVIGLIS MPFSLRDPNA VALLRYSPLP LEATVAIAVV SEGLHLVAGT AILKRRIWGR       120
     TLYAIVALAG FAISVFTTPF KGMLIIAAAL IALFLFILYR PAATAYFRQR AS               172
//

If you have problems or comments...

PBIL Back to PBIL home page