(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE558

CP000124.PE558       Location/Qualifiers
FT   CDS             579064..580593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0567"
FT                   /product="alkaline phosphatase family protein subfamily,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48062"
FT                   /db_xref="GOA:Q3JWS2"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS2"
FT                   /protein_id="ABA48062.1"
FT                   /translation="MLSIQFTFASHRPRIVLAFLKEITPTGSRNMKRVRLAALLGASVF
FT                   AAAGCGSDEPKTPGASDNGAQTGAARNVIFFLGDGMGMTTLTAARIYALGEDGALTLDT
FT                   LPETAFVKTYSNDAQVTDSAPSMSAYMTGVKTNNEVISMTPDTKAIEPSASLTGNCGAN
FT                   NGKPVPTLLEIAKAKGLATGVVTTTRVTHATPAATYAHVCHRDAENDIAAQLVPGGAGY
FT                   NAALGGGVDVVLGGGAQFFVPKEAGGKRADGRHLVNELKAKGYAIAQNRDELLAADATK
FT                   RGKLAGLFASSHMSYDLDRGATKEPSLADMATRALDVLQKNPNGYFLMVEGGRIDHALH
FT                   DTNAKRALQDTVAFDNAIKATLDKVRQTDPELKNTLVVVTADHDHTLVLNGYAARTGKT
FT                   EAGKPGVLGVLRNYQTGAVAKDADGAPYTIIGFGNGENRVQGSRAGTSLTDAVTGADDY
FT                   RQEAVVRMAKGGETHGGTDVFLGAIGRGADGFHGVIENNKVFELVRGAAQL"
     MLSIQFTFAS HRPRIVLAFL KEITPTGSRN MKRVRLAALL GASVFAAAGC GSDEPKTPGA        60
     SDNGAQTGAA RNVIFFLGDG MGMTTLTAAR IYALGEDGAL TLDTLPETAF VKTYSNDAQV       120
     TDSAPSMSAY MTGVKTNNEV ISMTPDTKAI EPSASLTGNC GANNGKPVPT LLEIAKAKGL       180
     ATGVVTTTRV THATPAATYA HVCHRDAEND IAAQLVPGGA GYNAALGGGV DVVLGGGAQF       240
     FVPKEAGGKR ADGRHLVNEL KAKGYAIAQN RDELLAADAT KRGKLAGLFA SSHMSYDLDR       300
     GATKEPSLAD MATRALDVLQ KNPNGYFLMV EGGRIDHALH DTNAKRALQD TVAFDNAIKA       360
     TLDKVRQTDP ELKNTLVVVT ADHDHTLVLN GYAARTGKTE AGKPGVLGVL RNYQTGAVAK       420
     DADGAPYTII GFGNGENRVQ GSRAGTSLTD AVTGADDYRQ EAVVRMAKGG ETHGGTDVFL       480
     GAIGRGADGF HGVIENNKVF ELVRGAAQL                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page