(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE560

CP000124.PE560       Location/Qualifiers
FT   CDS             583257..583970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0569"
FT                   /product="CutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50848"
FT                   /db_xref="GOA:Q3JWS0"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS0"
FT                   /protein_id="ABA50848.1"
FT                   /translation="MPASSILLEVIATTIGDARAAARAGADRIELVTAISEGGLTPSVG
FT                   VIEAVVAAVPIPVNVIVRPHSRSFSYDASELAAIARDVRAAVAAGANGIVFGMLDAHGD
FT                   IDLDALRRIADAADGRDLTFHRAFDVARDLNAAFDTLLRVPSVTSVLTSGGHPSVLDAR
FT                   DVVARMVRRAAGAACTVLAGAGLTVDALGDFVRATGVRAVHFGSGVRERGEVLAPIDER
FT                   LVAKARAALDAATRG"
     MPASSILLEV IATTIGDARA AARAGADRIE LVTAISEGGL TPSVGVIEAV VAAVPIPVNV        60
     IVRPHSRSFS YDASELAAIA RDVRAAVAAG ANGIVFGMLD AHGDIDLDAL RRIADAADGR       120
     DLTFHRAFDV ARDLNAAFDT LLRVPSVTSV LTSGGHPSVL DARDVVARMV RRAAGAACTV       180
     LAGAGLTVDA LGDFVRATGV RAVHFGSGVR ERGEVLAPID ERLVAKARAA LDAATRG          237
//

If you have problems or comments...

PBIL Back to PBIL home page