(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE561

CP000124.PE561       Location/Qualifiers
FT   CDS             584004..586283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR9"
FT                   /protein_id="ABA47844.1"
FT                   /translation="MAEAVAGECRAAHRAKKPGHRPAVLQEGSRRSGAQLRRLACPHAE
FT                   PREQLAVRFRARIAGREQHVAVEHRIRAGEEAQRLHRVVELLAARRQAHHRLRHRDARD
FT                   RDRTHELERIERLRVRERRAFDRDEIVDRHRFRIRVHVRELRDQARALAARFAHPDDPA
FT                   AAYVDARVAHALERVEAILVRARRDDLPIEFGRRVEVVVVIVEARLRQRLRLVFLEHAE
FT                   RHARLEAHVLHAADHFLDRLDVAILRVAPRGAHAEARRAVFLRGARGGEHRVHLHQLLR
FT                   LQAGVVMRGLRAVAAVLLAAARLDRQQRRELDRVRVEVLAVCLLRAEQQIVERQLVERD
FT                   HVGDAPARRGGRGHRCFGRRASGLSFSHVGHPSEQGSMRKIGKERLKRAAKTSARRGGA
FT                   QRVQQEVHVERVRRRVGRRRAHVRERAEQRRAVLAFEPRAQRVDVVVGEGHRRIDAVRD
FT                   PAGKGQAARGDRLGGEQCVADAAETHADDEHHGQPERDRQIGGIARVGERHAKAADAFD
FT                   DDDVRHLARAAMRVDDRADVERDALARGDDVRRGGRLQEKRRADRGGQRDVRGRVELVR
FT                   VFVAPCAVALVRARGHRLHRGRAQPRAREAVQQRGRYERLADLGIGTRHEQRKRRAHAA
FT                   APIGVTSAASRRARSSNECAADSEMRSRDVPAGTVGGRIAGTHRPCASSAAIAASVASL
FT                   LPITSGCTAVCESTGCQCVARRIARVRLISAPRCARRASPSSLAMTARLADTAHATDGG
FT                   AAVVKI"
     MAEAVAGECR AAHRAKKPGH RPAVLQEGSR RSGAQLRRLA CPHAEPREQL AVRFRARIAG        60
     REQHVAVEHR IRAGEEAQRL HRVVELLAAR RQAHHRLRHR DARDRDRTHE LERIERLRVR       120
     ERRAFDRDEI VDRHRFRIRV HVRELRDQAR ALAARFAHPD DPAAAYVDAR VAHALERVEA       180
     ILVRARRDDL PIEFGRRVEV VVVIVEARLR QRLRLVFLEH AERHARLEAH VLHAADHFLD       240
     RLDVAILRVA PRGAHAEARR AVFLRGARGG EHRVHLHQLL RLQAGVVMRG LRAVAAVLLA       300
     AARLDRQQRR ELDRVRVEVL AVCLLRAEQQ IVERQLVERD HVGDAPARRG GRGHRCFGRR       360
     ASGLSFSHVG HPSEQGSMRK IGKERLKRAA KTSARRGGAQ RVQQEVHVER VRRRVGRRRA       420
     HVRERAEQRR AVLAFEPRAQ RVDVVVGEGH RRIDAVRDPA GKGQAARGDR LGGEQCVADA       480
     AETHADDEHH GQPERDRQIG GIARVGERHA KAADAFDDDD VRHLARAAMR VDDRADVERD       540
     ALARGDDVRR GGRLQEKRRA DRGGQRDVRG RVELVRVFVA PCAVALVRAR GHRLHRGRAQ       600
     PRAREAVQQR GRYERLADLG IGTRHEQRKR RAHAAAPIGV TSAASRRARS SNECAADSEM       660
     RSRDVPAGTV GGRIAGTHRP CASSAAIAAS VASLLPITSG CTAVCESTGC QCVARRIARV       720
     RLISAPRCAR RASPSSLAMT ARLADTAHAT DGGAAVVKI                              759
//

If you have problems or comments...

PBIL Back to PBIL home page