(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE568

CP000124.PE568       Location/Qualifiers
FT   CDS             complement(590501..590953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48135"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR2"
FT                   /protein_id="ABA48135.1"
FT                   /translation="MQPTTNAPERPLDCPCGGAAPGANANARAPRYADCCARLIDGHAT
FT                   AATALELMRSRYSAYVLGATDYLRATWDPSTCPAELDADTGRAHAPRWLGLVIKRHAQL
FT                   DATHAEVEFVARYKIGGRAHRMHETSRFTRDAQGAWRYVDGDVSER"
     MQPTTNAPER PLDCPCGGAA PGANANARAP RYADCCARLI DGHATAATAL ELMRSRYSAY        60
     VLGATDYLRA TWDPSTCPAE LDADTGRAHA PRWLGLVIKR HAQLDATHAE VEFVARYKIG       120
     GRAHRMHETS RFTRDAQGAW RYVDGDVSER                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page