(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE569

CP000124.PE569       Location/Qualifiers
FT   CDS             complement(590985..591662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0578"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48357"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWR1"
FT                   /protein_id="ABA48357.1"
FT                   /translation="MKTVLIVGASRGIGREFVGQYLHDGWRVIATARDAAALAALDALG
FT                   ARALALDVAQPDDIAAFDARLGGAALDAAVVVSGVYGPRTAGVEPIGVEDFDAVMHTNV
FT                   LGPMLLMPILLPRVEASRGVLAVLSSKMGSIGEATGTTGWLYRASKAAVNDALRIASLQ
FT                   ARHAACIALHPGWVRTDMGGAQAALDPQASVAGMRRVIAQAAGDRERANGRFFQYDGVE
FT                   LGW"
     MKTVLIVGAS RGIGREFVGQ YLHDGWRVIA TARDAAALAA LDALGARALA LDVAQPDDIA        60
     AFDARLGGAA LDAAVVVSGV YGPRTAGVEP IGVEDFDAVM HTNVLGPMLL MPILLPRVEA       120
     SRGVLAVLSS KMGSIGEATG TTGWLYRASK AAVNDALRIA SLQARHAACI ALHPGWVRTD       180
     MGGAQAALDP QASVAGMRRV IAQAAGDRER ANGRFFQYDG VELGW                       225
//

If you have problems or comments...

PBIL Back to PBIL home page