(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE574

CP000124.PE574       Location/Qualifiers
FT   CDS             complement(597207..598853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0583"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48245"
FT                   /db_xref="GOA:Q3JWQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ6"
FT                   /protein_id="ABA48245.1"
FT                   /translation="MARTALAGALVALHHVSFRFDDGVTLFDSLDLTFDRAPSAIVGRN
FT                   GAGKSVLARLIAGRLAPTAGAIERHASIAFVAQHDADAMHDSRCTAAAVARLDAPLAAL
FT                   ERVARGDARADDFDLLDGRWDLAERWQAALDEAGLPPLDARTPAHALSGGQLARVAMIG
FT                   ALLSGADLLVADEPTNHLDAPGREWLRAALAGWRGGLVVVSHDRALLADVERIVELTPR
FT                   GARVYGGNYAAYRAQRDAEAQAAQAALDHAHAERERERRRLAREHDTIQRHAAATRRYA
FT                   ETANLPSGKRVSLKNSAREIMGRVRRDHRDTKTALGDAVQAAAARIEPDAPVLVSLPGT
FT                   EIAARRRLFTLDAARLPWLPAHARAATVTWSAHGPARIALTGPNGCGKSTLLRMLAGEC
FT                   APRAGRCDTHVPLAYLDQRLALLDPRRSVVEQLAALRTPLGQGELRSRLALLQLDATRA
FT                   TQPSARLSGGERLKAALACALWRETPAQLLLLDEPTNHLDLESVRAFEAALADFPGAIV
FT                   AVSHDAAFIDALAPTHAMRWTSEGWRFEPFA"
     MARTALAGAL VALHHVSFRF DDGVTLFDSL DLTFDRAPSA IVGRNGAGKS VLARLIAGRL        60
     APTAGAIERH ASIAFVAQHD ADAMHDSRCT AAAVARLDAP LAALERVARG DARADDFDLL       120
     DGRWDLAERW QAALDEAGLP PLDARTPAHA LSGGQLARVA MIGALLSGAD LLVADEPTNH       180
     LDAPGREWLR AALAGWRGGL VVVSHDRALL ADVERIVELT PRGARVYGGN YAAYRAQRDA       240
     EAQAAQAALD HAHAERERER RRLAREHDTI QRHAAATRRY AETANLPSGK RVSLKNSARE       300
     IMGRVRRDHR DTKTALGDAV QAAAARIEPD APVLVSLPGT EIAARRRLFT LDAARLPWLP       360
     AHARAATVTW SAHGPARIAL TGPNGCGKST LLRMLAGECA PRAGRCDTHV PLAYLDQRLA       420
     LLDPRRSVVE QLAALRTPLG QGELRSRLAL LQLDATRATQ PSARLSGGER LKAALACALW       480
     RETPAQLLLL DEPTNHLDLE SVRAFEAALA DFPGAIVAVS HDAAFIDALA PTHAMRWTSE       540
     GWRFEPFA                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page