(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE575

CP000124.PE575       Location/Qualifiers
FT   CDS             complement(599087..600673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0584"
FT                   /product="peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50148"
FT                   /db_xref="GOA:Q3JWQ5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ5"
FT                   /protein_id="ABA50148.1"
FT                   /translation="MRFTHIAAAALVAAASVAAAKPLTVCTESSPDGFDVVQYNSLVTT
FT                   NASADVVFNTLVSYDEATKKVVPALADKWDVSADGLAYTFHLRPNVAFQTTDSFKPTRA
FT                   LDADDVLFTFGRMLDDANPWHKVAGASGFPHAQSMGLAKLVKAVTKIDESTVKFELNEP
FT                   NATFVPILTMGFASIYSAEYADQLLKAGKQADLNAKPVGTGPFVLKSYTKDAVIRYEAN
FT                   PTYWGPKPKVERLIYAITPDPSVRAQKVKAGECQIALSPKPQDVAAAKADRALRVVETP
FT                   AFMTAFVALNTQKKPLDNDKVREALNLAFDRATYLKVVFDNTATPATNPYPPNTWSYAK
FT                   SIAPYPHDPAKAKQLLAQAGFPNGFSTTIWVRPTGSVLNPNPKAGAELLQADLAKIGVK
FT                   ADVRVIEWGELIKQAKLGQHDLLFMGFAGDNGDPDNILTPQFSCNSVKSGLNFARYCDP
FT                   KLDKLIADAKETTDQAKRAKLYEAAQKIIHDEALWIPLGYPTAAAITRPNVAGYRVSPF
FT                   GRQHFDAVSVQ"
     MRFTHIAAAA LVAAASVAAA KPLTVCTESS PDGFDVVQYN SLVTTNASAD VVFNTLVSYD        60
     EATKKVVPAL ADKWDVSADG LAYTFHLRPN VAFQTTDSFK PTRALDADDV LFTFGRMLDD       120
     ANPWHKVAGA SGFPHAQSMG LAKLVKAVTK IDESTVKFEL NEPNATFVPI LTMGFASIYS       180
     AEYADQLLKA GKQADLNAKP VGTGPFVLKS YTKDAVIRYE ANPTYWGPKP KVERLIYAIT       240
     PDPSVRAQKV KAGECQIALS PKPQDVAAAK ADRALRVVET PAFMTAFVAL NTQKKPLDND       300
     KVREALNLAF DRATYLKVVF DNTATPATNP YPPNTWSYAK SIAPYPHDPA KAKQLLAQAG       360
     FPNGFSTTIW VRPTGSVLNP NPKAGAELLQ ADLAKIGVKA DVRVIEWGEL IKQAKLGQHD       420
     LLFMGFAGDN GDPDNILTPQ FSCNSVKSGL NFARYCDPKL DKLIADAKET TDQAKRAKLY       480
     EAAQKIIHDE ALWIPLGYPT AAAITRPNVA GYRVSPFGRQ HFDAVSVQ                    528
//

If you have problems or comments...

PBIL Back to PBIL home page