(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE577

CP000124.PE577       Location/Qualifiers
FT   CDS             complement(601631..602125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0586"
FT                   /product="MarR family regulatory protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47606"
FT                   /db_xref="GOA:Q3JWQ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWQ3"
FT                   /protein_id="ABA47606.1"
FT                   /translation="MHMHFVRHRMLVVDKRFQRLPMSDAPMRLPCHCGTLRQATRAITS
FT                   LYDAHLARHGIRITQFTILAALHGGDALPTGELATRLLLDQTTLSRTLATLQSNQLVRA
FT                   ESGDDQRVRLWSLTPKGTALFKAARVDWEAAQNDVSRRIGKRNMQALDAGIFALAKALS
FT                   N"
     MHMHFVRHRM LVVDKRFQRL PMSDAPMRLP CHCGTLRQAT RAITSLYDAH LARHGIRITQ        60
     FTILAALHGG DALPTGELAT RLLLDQTTLS RTLATLQSNQ LVRAESGDDQ RVRLWSLTPK       120
     GTALFKAARV DWEAAQNDVS RRIGKRNMQA LDAGIFALAK ALSN                        164
//

If you have problems or comments...

PBIL Back to PBIL home page