(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE586

CP000124.PE586       Location/Qualifiers
FT   CDS             complement(610933..612012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0595"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /note="identified by match to protein family HMM PF02574"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50821"
FT                   /db_xref="GOA:Q3JWP4"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWP4"
FT                   /protein_id="ABA50821.1"
FT                   /translation="MSEPTPIAPFASSAAPAAPYTRGAALPQLLRQRILILDGAMGTMI
FT                   QRYKLDEAAYRGERFKDFPRDVKGNNELLSITQPRIIREIHDQYFAAGADIVETNTFGA
FT                   TAVAQADYGMEALVVEMNVASAALARESAAKYATPEKPRFVAGAIGPTPKTASISPDVN
FT                   DPGARNVTFDELRDAYYQQAKALLDGGVDLFLVETIFDTLNAKAALFALDQLFDDTGER
FT                   LPIMISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLC
FT                   DTYVSCYPNAGLPNPMSDTGFDETPDVTSGLLKEFAQAGLVNLAGGCCGTTPEHIAAIA
FT                   KALAEVKPRRWPSQYSEAA"
     MSEPTPIAPF ASSAAPAAPY TRGAALPQLL RQRILILDGA MGTMIQRYKL DEAAYRGERF        60
     KDFPRDVKGN NELLSITQPR IIREIHDQYF AAGADIVETN TFGATAVAQA DYGMEALVVE       120
     MNVASAALAR ESAAKYATPE KPRFVAGAIG PTPKTASISP DVNDPGARNV TFDELRDAYY       180
     QQAKALLDGG VDLFLVETIF DTLNAKAALF ALDQLFDDTG ERLPIMISGT VTDASGRILS       240
     GQTVEAFWNS LRHAKPLTFG LNCALGAALM RPYIAELAKL CDTYVSCYPN AGLPNPMSDT       300
     GFDETPDVTS GLLKEFAQAG LVNLAGGCCG TTPEHIAAIA KALAEVKPRR WPSQYSEAA        359
//

If you have problems or comments...

PBIL Back to PBIL home page