(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE59

CP000124.PE59        Location/Qualifiers
FT   CDS             complement(70304..71680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49133"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY71"
FT                   /protein_id="ABA49133.1"
FT                   /translation="MRRRRRRRLERIGKHRHRRRRHVRGRRLERRHRRHRRLGQHAARV
FT                   EPGGDHRQHGRRDHHQHADRQRDDLRARHVRVPDDRQRARRHRVVRAADRQHRRVGRAR
FT                   QPARVERERRHAHRVRQVRDELHVGHRAHRRREDRRRAGEFAADPDHRRSGLLRRAELV
FT                   LERQRAVEHRGRSRRERHSRDRARAVRLRRELHDVDALQQLLRVPERQHELPGHDGAAR
FT                   AAGRQPGAALCDRQQRRDRRNEPAGGRQRDGHADVRDQHPVEQRVAGGRDEAHLDDRGR
FT                   PDGHAARPCDHDGVLRYRLERVLLRYGRQHGGLAARVQQQFVVLLPVEHANDDGHRRRP
FT                   ERRAGLAVDLDRQRERAVFVVQIGGAESRRPVRQHAGARFRLAALFRQDTVLRDGPDWQ
FT                   RRCGAVCRVLTRRARASRSGARVTRIEGRTGARNRARLALVWHSTIEAAEPRGASAYHR
FT                   "
     MRRRRRRRLE RIGKHRHRRR RHVRGRRLER RHRRHRRLGQ HAARVEPGGD HRQHGRRDHH        60
     QHADRQRDDL RARHVRVPDD RQRARRHRVV RAADRQHRRV GRARQPARVE RERRHAHRVR       120
     QVRDELHVGH RAHRRREDRR RAGEFAADPD HRRSGLLRRA ELVLERQRAV EHRGRSRRER       180
     HSRDRARAVR LRRELHDVDA LQQLLRVPER QHELPGHDGA ARAAGRQPGA ALCDRQQRRD       240
     RRNEPAGGRQ RDGHADVRDQ HPVEQRVAGG RDEAHLDDRG RPDGHAARPC DHDGVLRYRL       300
     ERVLLRYGRQ HGGLAARVQQ QFVVLLPVEH ANDDGHRRRP ERRAGLAVDL DRQRERAVFV       360
     VQIGGAESRR PVRQHAGARF RLAALFRQDT VLRDGPDWQR RCGAVCRVLT RRARASRSGA       420
     RVTRIEGRTG ARNRARLALV WHSTIEAAEP RGASAYHR                               458
//

If you have problems or comments...

PBIL Back to PBIL home page