(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE592

CP000124.PE592       Location/Qualifiers
FT   CDS             complement(614060..616180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN8"
FT                   /protein_id="ABA48474.1"
FT                   /translation="MSRQACKSSVAKAGGRVIRRNPARVGRHGGPAGNPARAAPHACVR
FT                   ARTAAAWPPVRMAVSSGGVHRRDRLLDRAEDRLPRLVDHLDLHPVAVAHELGLRRAVLD
FT                   RLEAALLGDAAVAALRILVRHRARADDRARAHVARLRRVRDQLTEVKHHVDARIRLTDL
FT                   LAVPVDEHRAMQAAFAPVLAELVGRHGHRRERARRLALEEAEALRELGGNQVAQRHVVH
FT                   ERDEPHRFQRLVGRGAHRHVGRDHRDFRLEIDAPRLRCADDVVARAEEIVAAALVHQRI
FT                   GPELGRHLGAARAAHELDVVHVRGAVRPLERARQRRHAIGGLERERVARAAVVQCVVQV
FT                   AQLRRVERPVVEHALQRRRDRVGDRRRVQVARDDDQLAVARAVLERSKFHREMSRCSDD
FT                   GRNLFYDGESARRPAPRAAPSPFFPPRREQVRLALLRRPRRRPRRRSRHRRGKSPLRHP
FT                   VDRGRLSPARRADGRAARDDAARPRAARGDEPGEGAPLPRQFPAARARVAGSGVGPLRA
FT                   RRLRVADGPGAPRARRRREARAHRAHRAARSARPDGRHRGMGQPGADDRPLDGVEPSGE
FT                   GVAQARRRDAAPRLGDGPRVRRVPAARQDGRDDRARARRHAARRALYRPAHARRSRRGA
FT                   RRRARASRGARRRHAAADDQRIRDAGVRRGRRARARDHRARPRGRVRHPLGRRGRHRAA
FT                   HLRAEAVVRAWV"
     MSRQACKSSV AKAGGRVIRR NPARVGRHGG PAGNPARAAP HACVRARTAA AWPPVRMAVS        60
     SGGVHRRDRL LDRAEDRLPR LVDHLDLHPV AVAHELGLRR AVLDRLEAAL LGDAAVAALR       120
     ILVRHRARAD DRARAHVARL RRVRDQLTEV KHHVDARIRL TDLLAVPVDE HRAMQAAFAP       180
     VLAELVGRHG HRRERARRLA LEEAEALREL GGNQVAQRHV VHERDEPHRF QRLVGRGAHR       240
     HVGRDHRDFR LEIDAPRLRC ADDVVARAEE IVAAALVHQR IGPELGRHLG AARAAHELDV       300
     VHVRGAVRPL ERARQRRHAI GGLERERVAR AAVVQCVVQV AQLRRVERPV VEHALQRRRD       360
     RVGDRRRVQV ARDDDQLAVA RAVLERSKFH REMSRCSDDG RNLFYDGESA RRPAPRAAPS       420
     PFFPPRREQV RLALLRRPRR RPRRRSRHRR GKSPLRHPVD RGRLSPARRA DGRAARDDAA       480
     RPRAARGDEP GEGAPLPRQF PAARARVAGS GVGPLRARRL RVADGPGAPR ARRRREARAH       540
     RAHRAARSAR PDGRHRGMGQ PGADDRPLDG VEPSGEGVAQ ARRRDAAPRL GDGPRVRRVP       600
     AARQDGRDDR ARARRHAARR ALYRPAHARR SRRGARRRAR ASRGARRRHA AADDQRIRDA       660
     GVRRGRRARA RDHRARPRGR VRHPLGRRGR HRAAHLRAEA VVRAWV                      706
//

If you have problems or comments...

PBIL Back to PBIL home page