(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE593

CP000124.PE593       Location/Qualifiers
FT   CDS             615011..616003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0602"
FT                   /product="fumarylacetoacetate (FAA) hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47600"
FT                   /db_xref="GOA:Q3JWN7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN7"
FT                   /protein_id="ABA47600.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFY
FT                   APQLRDLYDALNHGRARNAFAFEPADCMAPLPRAFQWADGSAYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFLGPRDDIVCASEAWGIDFEAEVAVITADVPMGAAPDEALKAV
FT                   RLVTLVNDVSLRNLIPAELAKGFGFFQSKPASAFAPVAVTPDELGEHWREGRLHRPMLV
FT                   HWNGKKVGQPDAGVDMVFHFGQLIAHAAKTRNVRAGSIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMRYGDRVKIEMVDEAGKSIFGAIEQAVAPVDAAA"
     MKLASLKDGT RDGQLIVVSR DLHTAAIADA IAPTLQRVLD DWAFYAPQLR DLYDALNHGR        60
     ARNAFAFEPA DCMAPLPRAF QWADGSAYVN HVELVRRARG AEMPPEFWTD PLMYQGGSDD       120
     FLGPRDDIVC ASEAWGIDFE AEVAVITADV PMGAAPDEAL KAVRLVTLVN DVSLRNLIPA       180
     ELAKGFGFFQ SKPASAFAPV AVTPDELGEH WREGRLHRPM LVHWNGKKVG QPDAGVDMVF       240
     HFGQLIAHAA KTRNVRAGSI VGSGTVSNKD AKRGYCCIAE KRCLETIEHG APQTEFMRYG       300
     DRVKIEMVDE AGKSIFGAIE QAVAPVDAAA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page