(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE595

CP000124.PE595       Location/Qualifiers
FT   CDS             617128..617937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN5"
FT                   /protein_id="ABA48898.1"
FT                   /translation="MTDPNGSNPFSGFGGFQPAGFLDKMWDMMRLTPFGAMSALPGASQ
FT                   GLPPSLSAMSDLMAPLASVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLAT
FT                   LRAFGALAQTSMAAAEAALSPDDSAPREPASAAASASAAKREASAGEPADAQGARDADG
FT                   ETPPPGADAFDPAGWWNLLQSQFNQLARFAMTQPGMAAAGDAPAAGAAAGPKPSAAKKP
FT                   ATRRAAAPRTGGSAADRAPGASSASSASSAGGDAKPAAAKKPARRGA"
     MTDPNGSNPF SGFGGFQPAG FLDKMWDMMR LTPFGAMSAL PGASQGLPPS LSAMSDLMAP        60
     LASVEELDKR ITDLRAVEQW LKLNLGMLQS AIQALEVQRA TLATLRAFGA LAQTSMAAAE       120
     AALSPDDSAP REPASAAASA SAAKREASAG EPADAQGARD ADGETPPPGA DAFDPAGWWN       180
     LLQSQFNQLA RFAMTQPGMA AAGDAPAAGA AAGPKPSAAK KPATRRAAAP RTGGSAADRA       240
     PGASSASSAS SAGGDAKPAA AKKPARRGA                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page