(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE596

CP000124.PE596       Location/Qualifiers
FT   CDS             617974..619218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0605"
FT                   /product="Patatin"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50620"
FT                   /db_xref="GOA:Q3JWN4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN4"
FT                   /protein_id="ABA50620.1"
FT                   /translation="MRLALVLMGGGARAAYQAGVLKGLAEIAHDVDPKRRTSPFSVICG
FT                   SSAGAINATSLASHADDFEHGVRRLLEFWEQLRAERVYRTDWLGIAAAGARWLAAMSIG
FT                   WAARRSPRGLLDNAPLAYLLRRELDFHRIELMLEARKLHALSVTALSYSSGRHLTFYQA
FT                   SEPIQAWRRAERTARMVDLSAEHLLASSAIPFVFPAVPLVLDGQIEYFGDGSIRQIAPL
FT                   SPAIHFGSDRIVVVGAADPRPEVPAANGNGRGYPSLAQIGQQVLASVFLDSIGADIERI
FT                   DHVNRMIEHLPAYVEPESGWRHVDVLAIAPSERIELIASKHLKRLPLTVRGLLGAVGGN
FT                   KPAGASFASYLLFEAEFTRELVELGYRDAHGQRERLAQWIASAERRGGPAERGPGAGTD
FT                   ARTGAGAHAARRTTT"
     MRLALVLMGG GARAAYQAGV LKGLAEIAHD VDPKRRTSPF SVICGSSAGA INATSLASHA        60
     DDFEHGVRRL LEFWEQLRAE RVYRTDWLGI AAAGARWLAA MSIGWAARRS PRGLLDNAPL       120
     AYLLRRELDF HRIELMLEAR KLHALSVTAL SYSSGRHLTF YQASEPIQAW RRAERTARMV       180
     DLSAEHLLAS SAIPFVFPAV PLVLDGQIEY FGDGSIRQIA PLSPAIHFGS DRIVVVGAAD       240
     PRPEVPAANG NGRGYPSLAQ IGQQVLASVF LDSIGADIER IDHVNRMIEH LPAYVEPESG       300
     WRHVDVLAIA PSERIELIAS KHLKRLPLTV RGLLGAVGGN KPAGASFASY LLFEAEFTRE       360
     LVELGYRDAH GQRERLAQWI ASAERRGGPA ERGPGAGTDA RTGAGAHAAR RTTT             414
//

If you have problems or comments...

PBIL Back to PBIL home page