(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE600

CP000124.PE600       Location/Qualifiers
FT   CDS             complement(622672..623940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0609"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="identified by match to protein family HMM PF02237;
FT                   match to protein family HMM PF03099; match to protein
FT                   family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49375"
FT                   /db_xref="GOA:Q3JWN0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN0"
FT                   /protein_id="ABA49375.1"
FT                   /translation="MSDRTQGRSSASCDAPHHAASHRIALRRAGRRTRHPTRRRTASAE
FT                   PARQNAAAHPIARRRPHAAMMGASPTEPRKAAIRPPVKRRARRTLRWQPSISSATIRAM
FT                   NVATPPSMPATGGPLIDRARVDAHLAPAAREWSIEIVDTTGSTNADLGARLKALPRRRD
FT                   ALAAPIARVAYEQTAGRGRQGRPWFAKPGDALLCSVACVLPRPVGALAGLSLAVGAALA
FT                   EAFAARPAATGDAPRGDADGARRIALKWPNDLLVATERDGETAIVGKLAGVLIETVWNT
FT                   IDATAVVIGFGVNVRTADAAAAEVDALRARDATLAGGLPPVALAAVRAGATLTDTFAAA
FT                   LNALAVALPAFAADGLAPFAARWHALHAYAGREVVLLERGAELARGVAVGIDETGQLLL
FT                   DTPAGRQAIAAGDVSLRTPGAAR"
     MSDRTQGRSS ASCDAPHHAA SHRIALRRAG RRTRHPTRRR TASAEPARQN AAAHPIARRR        60
     PHAAMMGASP TEPRKAAIRP PVKRRARRTL RWQPSISSAT IRAMNVATPP SMPATGGPLI       120
     DRARVDAHLA PAAREWSIEI VDTTGSTNAD LGARLKALPR RRDALAAPIA RVAYEQTAGR       180
     GRQGRPWFAK PGDALLCSVA CVLPRPVGAL AGLSLAVGAA LAEAFAARPA ATGDAPRGDA       240
     DGARRIALKW PNDLLVATER DGETAIVGKL AGVLIETVWN TIDATAVVIG FGVNVRTADA       300
     AAAEVDALRA RDATLAGGLP PVALAAVRAG ATLTDTFAAA LNALAVALPA FAADGLAPFA       360
     ARWHALHAYA GREVVLLERG AELARGVAVG IDETGQLLLD TPAGRQAIAA GDVSLRTPGA       420
     AR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page