(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE606

CP000124.PE606       Location/Qualifiers
FT   CDS             630219..630857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48512"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM4"
FT                   /protein_id="ABA48512.1"
FT                   /translation="MHAHFMSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYD
FT                   LGPAQPAASSGTGPALKVLDVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQL
FT                   LTQRLRGALSGRGAVLAADDGVRAPVLKVELSEFEQVFDGRSESHAAVTARATLTQEGK
FT                   VLGQRTFVSRAPASTPDAAGGAQALATASDALVSQLVAWLGVQAYAAAQ"
     MHAHFMSGSL SRRGRPALAL AVALVMASAS GCAGTPAALA NIRYDLGPAQ PAASSGTGPA        60
     LKVLDVSAPD ALNTDRFVYR LAYSDAQRIA AYRDSKWTAP PAQLLTQRLR GALSGRGAVL       120
     AADDGVRAPV LKVELSEFEQ VFDGRSESHA AVTARATLTQ EGKVLGQRTF VSRAPASTPD       180
     AAGGAQALAT ASDALVSQLV AWLGVQAYAA AQ                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page