(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE62

CP000124.PE62        Location/Qualifiers
FT   CDS             complement(71780..72283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51174"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY68"
FT                   /protein_id="ABA51174.1"
FT                   /translation="MRSSRFRRLAATAAGFMCAWLAAPAHAGLGGAPMTPPAADTAATV
FT                   RSIQRSIRAAGGASTAAVGYTVRETTLGSGTVVREYVSTAGTVFALSWQGPVAPNLSDL
FT                   LGAYFPQYEAGVKASRAAHGPRAPAAIDTGGLVVHTGGHMGSYSGQAWLPQALPAGFST
FT                   NDIQ"
     MRSSRFRRLA ATAAGFMCAW LAAPAHAGLG GAPMTPPAAD TAATVRSIQR SIRAAGGAST        60
     AAVGYTVRET TLGSGTVVRE YVSTAGTVFA LSWQGPVAPN LSDLLGAYFP QYEAGVKASR       120
     AAHGPRAPAA IDTGGLVVHT GGHMGSYSGQ AWLPQALPAG FSTNDIQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page